PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 392aa    MW: 42706.1 Da    PI: 5.4451
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20802.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.64e-061960439
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
               r+C+++     + +C+ ++ +lC  C   +H        H++
  PK20802.1 19 RVCDTCRAAACTVYCRADSAYLCSGCDARIHAAnrvasrHER 60
               79******99*********************55567777765 PP

2zf-B_box28.92.4e-0961105341
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                 ++C+ +e+ ++ + C+ +   lC++C   +H+       H +vp
  PK20802.1  61 VWVCEACERAPAAFICKADAASLCATCDADIHSAnplarrHHRVP 105
                689*****************************6688999977776 PP

3CCT70.34.9e-24323366144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  PK20802.1 323 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 366
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.2391663IPR000315B-box-type zinc finger
SMARTSM003365.3E-81663IPR000315B-box-type zinc finger
CDDcd000213.70E-81963No hitNo description
PROSITE profilePS5011910.93659106IPR000315B-box-type zinc finger
PfamPF006434.6E-760105IPR000315B-box-type zinc finger
CDDcd000215.27E-962106No hitNo description
SMARTSM003362.0E-964106IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648323365IPR010402CCT domain
PfamPF062037.7E-18323365IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MKDETTGSGP GGGTKAWARV CDTCRAAACT VYCRADSAYL CSGCDARIHA ANRVASRHER  60
VWVCEACERA PAAFICKADA ASLCATCDAD IHSANPLARR HHRVPVLPIS GPPSVDRVGS  120
GGDGFFSQLE GNEGMDDIQE PDEEEDDESE AASWLLLNPV KNGQNQGNGY LFGGEVDEYL  180
DLVEYNSGVD NQFGDHNNNN NHHQYSQSNN QMQQSYGVSQ QKSYGGGGGD SVVPVQCGYG  240
KSQLQQSQTG FQLGLDFESS KSGYSYNGSI SHSVSVSSMD VSVVPDSTMS DISISNPRPP  300
KGTIDLFSGP PIQMPTQLTP MDREARVLRY REKKKTRKFE KTIRYASRKA YAETRPRIKG  360
RFAKRTDVEV EVDQMFSTAL MADNGYGIVP SF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532886.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-151COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLB9T3R70.0B9T3R7_RICCO; Zinc finger protein, putative
STRINGPOPTR_0017s14410.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-121CONSTANS-like 2